Lineage for d1gvjb_ (1gvj B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.21: ets domain [46859] (9 proteins) Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries) 
Domain d1gvjb_: 1gvj B: [90526]
Details for d1gvjb_
PDB Entry: 1gvj (more details), 1.53 Å
PDB Description: ets-1 dna binding and autoinhibitory domains
PDB Compounds: (B:) c-ets-1 proteinSCOPe Domain Sequences for d1gvjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvjb_ a.4.5.21 (B:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
mnhkpkgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfis
wtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfv
cdlqsllgytpeelhamldvkpdade
SCOPe Domain Coordinates for d1gvjb_:
Click to download the PDB-style file with coordinates for d1gvjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gvjb_:
- d1gvjb_ first appeared in SCOP 1.67
- d1gvjb_ appears in SCOPe 2.06
- d1gvjb_ appears in the current release, SCOPe 2.08, called d1gvjb1
View in 3D
