Lineage for d1gvja_ (1gvj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721885Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1721893Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 1721894Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries)
  8. 1721895Domain d1gvja_: 1gvj A: [90525]

Details for d1gvja_

PDB Entry: 1gvj (more details), 1.53 Å

PDB Description: ets-1 dna binding and autoinhibitory domains
PDB Compounds: (A:) c-ets-1 protein

SCOPe Domain Sequences for d1gvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
mnhkpkgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfis
wtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfv
cdlqsllgytpeelhamldvkp

SCOPe Domain Coordinates for d1gvja_:

Click to download the PDB-style file with coordinates for d1gvja_.
(The format of our PDB-style files is described here.)

Timeline for d1gvja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gvjb_