Lineage for d1gvja_ (1gvj A:)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) 
contains a small beta-sheet (wing)
Family a.4.5.21: ets domain [46859] (6 proteins) Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries) 
Domain d1gvja_: 1gvj A: [90525]
Details for d1gvja_
PDB Entry: 1gvj (more details), 1.53 Å
PDB Description: ets-1 dna binding and autoinhibitory domains
SCOP Domain Sequences for d1gvja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens)}
mnhkpkgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfis
wtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfv
cdlqsllgytpeelhamldvkp
SCOP Domain Coordinates for d1gvja_:
Click to download the PDB-style file with coordinates for d1gvja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gvja_:
- d1gvja_ is new in SCOP 1.67
- d1gvja_ appears in SCOP 1.69
- d1gvja_ appears in the current release, SCOPe 2.08
View in 3D
