SCOP 1.67: Domain d1gt5b_: 1gt5 B:

Lineage for d1gt5b_ (1gt5 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)

8. Domain d1gt5b_: 1gt5 B: [90522]
   complexed with bzq

Details for d1gt5b_

PDB Entry: 1gt5, 2.08 Å

PDB Description: complexe of bovine odorant binding protein with benzophenone

SCOP Domain Sequences for d1gt5b_:

Sequence; same for both SEQRES and ATOM records:

>d1gt5b_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus)}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltelfvkl
nvededlekfwkltedkgidkknvvnflenenhphp

Timeline for d1gt5b_:

• d1gt5b_ is new in SCOP 1.67
  
• d1gt5b_ appears in SCOP 1.69
  
• d1gt5b_ appears in the current release, SCOPe 2.08