SCOPe 2.07: Domain d1gt3b_: 1gt3 B:

Lineage for d1gt3b_ (1gt3 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)

8. Domain d1gt3b_: 1gt3 B: [90518]
   complexed with 3om, dhm

Details for d1gt3b_

PDB Entry: 1gt3, 1.8 Å

PDB Description: Complex of Bovine Odorant Binding Protein with dihydromyrcenol

PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d1gt3b_:

Sequence; same for both SEQRES and ATOM records:

>d1gt3b_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltelfvkl
nvededlekfwkltedkgidkknvvnflenenhphp

Timeline for d1gt3b_:

• d1gt3b_ first appeared in SCOP 1.67
  
• d1gt3b_ appears in SCOPe 2.06
  
• d1gt3b_ appears in the current release, SCOPe 2.08