Lineage for d1g8sa_ (1g8s A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2469039Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
    automatically mapped to Pfam PF01269
  6. 2469040Protein Fibrillarin homologue [53343] (4 species)
  7. 2469043Species Methanococcus jannaschii [TaxId:2190] [53344] (2 PDB entries)
  8. 2469045Domain d1g8sa_: 1g8s A: [90507]
    structural genomics
    complexed with met

Details for d1g8sa_

PDB Entry: 1g8s (more details), 1.6 Å

PDB Description: methanococcus jannaschii fibrillarin pre-rrna processing protein
PDB Compounds: (A:) fibrillarin-like pre-rRNA processing protein

SCOPe Domain Sequences for d1g8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Methanococcus jannaschii [TaxId: 2190]}
medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnkskla
aaiikglkvmpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacae
reniipilgdankpqeyanivekvdviyedvaqpnqaeiliknakwflkkggygmiaika
rsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk

SCOPe Domain Coordinates for d1g8sa_:

Click to download the PDB-style file with coordinates for d1g8sa_.
(The format of our PDB-style files is described here.)

Timeline for d1g8sa_: