SCOPe 2.03: Domain d1fwmb_: 1fwm B:

Lineage for d1fwmb_ (1fwm B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (63 PDB entries)

8. Domain d1fwmb_: 1fwm B: [90501]
   complexed with cb3, so4; mutant

Details for d1fwmb_

PDB Entry: 1fwm, 2.2 Å

PDB Description: crystal structure of the thymidylate synthase r166q mutant

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1fwmb_:

Sequence; same for both SEQRES and ATOM records:

>d1fwmb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqqscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1fwmb_:

• d1fwmb_ first appeared in SCOP 1.67
  
• d1fwmb_ appears in SCOPe 2.02
  
• d1fwmb_ appears in SCOPe 2.04
  
• d1fwmb_ appears in the current release, SCOPe 2.08