Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Ornithine transcarbamoylase [53676] (6 species) |
Species Sheep (Ovis aries) [TaxId:9940] [102666] (1 PDB entry) |
Domain d1fb5a1: 1fb5 A:35-184 [90492] complexed with nva |
PDB Entry: 1fb5 (more details), 3.5 Å
SCOPe Domain Sequences for d1fb5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fb5a1 c.78.1.1 (A:35-184) Ornithine transcarbamoylase {Sheep (Ovis aries) [TaxId: 9940]} vqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrtr lstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdletlake asipvinglsdlyhpiqiladyltlqehys
Timeline for d1fb5a1: