SCOPe 2.06: Domain d1fb5a1: 1fb5 A:35-184

Lineage for d1fb5a1 (1fb5 A:35-184)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [102666] (1 PDB entry)

8. Domain d1fb5a1: 1fb5 A:35-184 [90492]
   complexed with nva

Details for d1fb5a1

PDB Entry: 1fb5, 3.5 Å

PDB Description: low resolution structure of ovine ornithine transcarbmoylase in the unliganded state

PDB Compounds: (A:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1fb5a1:

Sequence; same for both SEQRES and ATOM records:

>d1fb5a1 c.78.1.1 (A:35-184) Ornithine transcarbamoylase {Sheep (Ovis aries) [TaxId: 9940]}
vqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrtr
lstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdletlake
asipvinglsdlyhpiqiladyltlqehys

Timeline for d1fb5a1:

• d1fb5a1 first appeared in SCOP 1.67
  
• d1fb5a1 appears in SCOPe 2.05
  
• d1fb5a1 appears in SCOPe 2.07
  
• d1fb5a1 appears in the current release, SCOPe 2.08