Lineage for d1f9qb_ (1f9q B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407213Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 407214Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 407215Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 protein domains)
  6. 407351Protein Platelet factor 4, PF4 [54121] (2 species)
  7. 407357Species Human (Homo sapiens) [TaxId:9606] [54123] (6 PDB entries)
  8. 407359Domain d1f9qb_: 1f9q B: [90481]

Details for d1f9qb_

PDB Entry: 1f9q (more details), 2 Å

PDB Description: crystal structure of platelet factor 4

SCOP Domain Sequences for d1f9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9qb_ d.9.1.1 (B:) Platelet factor 4, PF4 {Human (Homo sapiens)}
qclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykkiikkll
es

SCOP Domain Coordinates for d1f9qb_:

Click to download the PDB-style file with coordinates for d1f9qb_.
(The format of our PDB-style files is described here.)

Timeline for d1f9qb_: