| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
| Protein Platelet basic protein, PBP [54148] (1 species) synonym: Small inducible cytokine B7; Neutrophil-activating peptide-2 (NAP-2), Connective tissue activating peptide-III (CTAP-III) |
| Species Human (Homo sapiens) [TaxId:9606] [54149] (3 PDB entries) |
| Domain d1f9pa_: 1f9p A: [90479] complexed with esa |
PDB Entry: 1f9p (more details), 1.93 Å
SCOPe Domain Sequences for d1f9pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9pa_ d.9.1.1 (A:) Platelet basic protein, PBP {Human (Homo sapiens) [TaxId: 9606]}
nlakgkeesldsdlyaelrcmcikttsgihpkniqslevigkgthcnqveviatlkdgrk
icldpdaprikkivqkklagd
Timeline for d1f9pa_: