Lineage for d1f9pa_ (1f9p A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175506Protein Platelet basic protein, PBP [54148] (1 species)
    synonym: Small inducible cytokine B7; Neutrophil-activating peptide-2 (NAP-2), Connective tissue activating peptide-III (CTAP-III)
  7. 2175507Species Human (Homo sapiens) [TaxId:9606] [54149] (3 PDB entries)
  8. 2175516Domain d1f9pa_: 1f9p A: [90479]
    complexed with esa

Details for d1f9pa_

PDB Entry: 1f9p (more details), 1.93 Å

PDB Description: crystal structure of connective tissue activating peptide-iii(ctap- iii) complexed with polyvinylsulfonic acid
PDB Compounds: (A:) connective tissue activating peptide-III

SCOPe Domain Sequences for d1f9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9pa_ d.9.1.1 (A:) Platelet basic protein, PBP {Human (Homo sapiens) [TaxId: 9606]}
nlakgkeesldsdlyaelrcmcikttsgihpkniqslevigkgthcnqveviatlkdgrk
icldpdaprikkivqkklagd

SCOPe Domain Coordinates for d1f9pa_:

Click to download the PDB-style file with coordinates for d1f9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1f9pa_: