SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1f9pa_ (1f9p A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156493Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2156494Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2156495Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2156660Protein Platelet basic protein, PBP [54148] (1 species)
    synonym: Small inducible cytokine B7; Neutrophil-activating peptide-2 (NAP-2), Connective tissue activating peptide-III (CTAP-III)
  7. 2156661Species Human (Homo sapiens) [TaxId:9606] [54149] (3 PDB entries)
  8. 2156670Domain d1f9pa_: 1f9p A: [90479]
    complexed with esa

Details for d1f9pa_

PDB Entry: 1f9p (more details), 1.93 Å

PDB Description: crystal structure of connective tissue activating peptide-iii(ctap-iii) complexed with polyvinylsulfonic acid
PDB Compounds: (A:) connective tissue activating peptide-III

SCOPe Domain Sequences for d1f9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9pa_ d.9.1.1 (A:) Platelet basic protein, PBP {Human (Homo sapiens) [TaxId: 9606]}
nlakgkeesldsdlyaelrcmcikttsgihpkniqslevigkgthcnqveviatlkdgrk
icldpdaprikkivqkklagd

SCOPe Domain Coordinates for d1f9pa_:

Click to download the PDB-style file with coordinates for d1f9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1f9pa_: