Lineage for d1f2za_ (1f2z A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381453Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2381454Family b.40.1.1: Staphylococcal nuclease [50200] (2 protein domains)
    barrel, closed; n=5, S=10
  6. 2381455Protein Staphylococcal nuclease [50201] (1 species)
  7. 2381456Species Staphylococcus aureus [TaxId:1280] [50202] (256 PDB entries)
    Uniprot P00644 89-223
  8. 2381491Domain d1f2za_: 1f2z A: [90476]

Details for d1f2za_

PDB Entry: 1f2z (more details), 1.8 Å

PDB Description: simplification of a protein loop in staphylococcal nuclease
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1f2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2za_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvaapnntheqhl
rkseaqakkeklniws

SCOPe Domain Coordinates for d1f2za_:

Click to download the PDB-style file with coordinates for d1f2za_.
(The format of our PDB-style files is described here.)

Timeline for d1f2za_: