SCOPe 2.08: Domain d1eyfa_: 1eyf A:

Lineage for d1eyfa_ (1eyf A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.48: Ada DNA repair protein, N-terminal domain (N-Ada 10) [57883] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.48.1: Ada DNA repair protein, N-terminal domain (N-Ada 10) [57884] (1 family)

5. Family g.48.1.1: Ada DNA repair protein, N-terminal domain (N-Ada 10) [57885] (1 protein)

6. Protein Ada DNA repair protein, N-terminal domain (N-Ada 10) [57886] (1 species)
   (crystal structure of the rest of protein is also published)

7. Species Escherichia coli [TaxId:562] [57887] (2 PDB entries)

8. Domain d1eyfa_: 1eyf A: [90473]
   refined solution structure
   complexed with zn

Details for d1eyfa_

PDB Entry: 1eyf

PDB Description: refined structure of the dna methyl phosphotriester repair domain of e. coli ada

PDB Compounds: (A:) ada regulatory protein

SCOPe Domain Sequences for d1eyfa_:

Sequence; same for both SEQRES and ATOM records:

>d1eyfa_ g.48.1.1 (A:) Ada DNA repair protein, N-terminal domain (N-Ada 10) {Escherichia coli [TaxId: 562]}
mkkatcltddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanase
alaagfrpckrcqpdkanprqhrldkithacr

Timeline for d1eyfa_:

• d1eyfa_ first appeared in SCOP 1.67
  
• d1eyfa_ appears in SCOPe 2.07