Lineage for d1ex0b4 (1ex0 B:191-511)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 406501Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 406502Superfamily d.3.1: Cysteine proteinases [54001] (10 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 406718Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 406719Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 406720Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries)
    Coagulation factor XIII
  8. 406722Domain d1ex0b4: 1ex0 B:191-511 [90472]
    Other proteins in same PDB: d1ex0a1, d1ex0a2, d1ex0a3, d1ex0b1, d1ex0b2, d1ex0b3
    complexed with ca, pgo, po4; mutant

Details for d1ex0b4

PDB Entry: 1ex0 (more details), 2 Å

PDB Description: human factor xiii, mutant w279f zymogen

SCOP Domain Sequences for d1ex0b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex0b4 d.3.1.4 (B:191-511) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgsfdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntsrs

SCOP Domain Coordinates for d1ex0b4:

Click to download the PDB-style file with coordinates for d1ex0b4.
(The format of our PDB-style files is described here.)

Timeline for d1ex0b4: