Lineage for d1ex0b1 (1ex0 B:5-190)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 368074Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 368075Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 368076Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (8 PDB entries)
    Coagulation factor XIII
  8. 368078Domain d1ex0b1: 1ex0 B:5-190 [90469]
    Other proteins in same PDB: d1ex0a2, d1ex0a3, d1ex0a4, d1ex0b2, d1ex0b3, d1ex0b4
    complexed with ca, pgo, po4; mutant

Details for d1ex0b1

PDB Entry: 1ex0 (more details), 2 Å

PDB Description: human factor xiii, mutant w279f zymogen

SCOP Domain Sequences for d1ex0b1:

Sequence, based on SEQRES records: (download)

>d1ex0b1 b.1.18.9 (B:5-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme}
rtafggrravppnnsnaaeddlptvelqgvnlrgvnlqeflnvtsvhlfkerwdtnkvdh
htdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivse
lqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilf
npwced

Sequence, based on observed residues (ATOM records): (download)

>d1ex0b1 b.1.18.9 (B:5-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme}
rtafggrravppnnsnaaeddlptvelqgvnlqeflnvtsvhlfkerwdtnkvdhhtdky
ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
d

SCOP Domain Coordinates for d1ex0b1:

Click to download the PDB-style file with coordinates for d1ex0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ex0b1: