Lineage for d1ex0a3 (1ex0 A:628-727)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763296Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2763297Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2763298Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2763299Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries)
    Coagulation factor XIII,
  8. 2763321Domain d1ex0a3: 1ex0 A:628-727 [90467]
    Other proteins in same PDB: d1ex0a1, d1ex0a4, d1ex0b1, d1ex0b4
    complexed with ca, pgo, po4; mutant

Details for d1ex0a3

PDB Entry: 1ex0 (more details), 2 Å

PDB Description: human factor xiii, mutant w279f zymogen
PDB Compounds: (A:) coagulation factor xiii a chain

SCOPe Domain Sequences for d1ex0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOPe Domain Coordinates for d1ex0a3:

Click to download the PDB-style file with coordinates for d1ex0a3.
(The format of our PDB-style files is described here.)

Timeline for d1ex0a3: