Lineage for d1eqqc_ (1eqq C:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
barrel, closed; n=5, S=10
Protein ssDNA-binding protein [50264] (3 species) 
Species Escherichia coli [TaxId:562] [50266] (4 PDB entries) 
Domain d1eqqc_: 1eqq C: [90463]
Details for d1eqqc_
PDB Entry: 1eqq (more details), 3.2 Å
PDB Description: single stranded dna binding protein and ssdna complex
SCOP Domain Sequences for d1eqqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqqc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
SCOP Domain Coordinates for d1eqqc_:
Click to download the PDB-style file with coordinates for d1eqqc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eqqc_:
- d1eqqc_ is new in SCOP 1.67
- d1eqqc_ appears in SCOP 1.69
- d1eqqc_ appears in the current release, SCOPe 2.08
View in 3D
