Lineage for d1eqqc_ (1eqq C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789438Protein ssDNA-binding protein [50264] (4 species)
  7. 2789441Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
    Uniprot P02339
  8. 2789464Domain d1eqqc_: 1eqq C: [90463]
    complexed with ssDNA
    protein/DNA complex; protein/RNA complex
    has additional insertions and/or extensions that are not grouped together
    missing some secondary structures that made up less than one-third of the common domain

Details for d1eqqc_

PDB Entry: 1eqq (more details), 3.2 Å

PDB Description: single stranded dna binding protein and ssdna complex
PDB Compounds: (C:) single stranded DNA binding protein

SCOPe Domain Sequences for d1eqqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqqc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg

SCOPe Domain Coordinates for d1eqqc_:

Click to download the PDB-style file with coordinates for d1eqqc_.
(The format of our PDB-style files is described here.)

Timeline for d1eqqc_: