Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein ssDNA-binding protein [50264] (4 species) |
Species Escherichia coli [TaxId:562] [50266] (6 PDB entries) Uniprot P02339 |
Domain d1eqqc_: 1eqq C: [90463] complexed with ssDNA protein/DNA complex; protein/RNA complex has additional insertions and/or extensions that are not grouped together missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1eqq (more details), 3.2 Å
SCOPe Domain Sequences for d1eqqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqqc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
Timeline for d1eqqc_: