Lineage for d1em8a_ (1em8 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530130Fold c.128: DNA polymerase III chi subunit [102399] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 7 strands, order 7165243
  4. 2530131Superfamily c.128.1: DNA polymerase III chi subunit [102400] (1 family) (S)
    structural similarity and possible evolutionary relationship to the AAA domain; lacks the P-loop motif
    automatically mapped to Pfam PF04364
  5. 2530132Family c.128.1.1: DNA polymerase III chi subunit [102401] (2 proteins)
  6. 2530133Protein DNA polymerase III chi subunit [102402] (1 species)
  7. 2530134Species Escherichia coli [TaxId:562] [102403] (1 PDB entry)
  8. 2530135Domain d1em8a_: 1em8 A: [90457]
    Other proteins in same PDB: d1em8b_, d1em8d_

Details for d1em8a_

PDB Entry: 1em8 (more details), 2.1 Å

PDB Description: crystal structure of chi and psi subunit heterodimer from dna pol iii
PDB Compounds: (A:) DNA polymerase III chi subunit

SCOPe Domain Sequences for d1em8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em8a_ c.128.1.1 (A:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]}
mknatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarp
aesfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpye
dslkqlarerykayrvagfnlntatwk

SCOPe Domain Coordinates for d1em8a_:

Click to download the PDB-style file with coordinates for d1em8a_.
(The format of our PDB-style files is described here.)

Timeline for d1em8a_: