Lineage for d1ei6c_ (1ei6 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138610Family c.76.1.4: Phosphonoacetate hydrolase [102651] (1 protein)
    contains alpha+beta subdomain inserted near C-terminus
    automatically mapped to Pfam PF01663
  6. 2138611Protein Phosphonoacetate hydrolase [102652] (1 species)
  7. 2138612Species Pseudomonas fluorescens [TaxId:294] [102653] (1 PDB entry)
  8. 2138615Domain d1ei6c_: 1ei6 C: [90445]
    complexed with ppf, tla, zn

Details for d1ei6c_

PDB Entry: 1ei6 (more details), 2.1 Å

PDB Description: crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
PDB Compounds: (C:) phosphonoacetate hydrolase

SCOPe Domain Sequences for d1ei6c_:

Sequence, based on SEQRES records: (download)

>d1ei6c_ c.76.1.4 (C:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]}
tnlisvnsrsyrlssaptivicvdgceqeyinqaiqagqapflaeltgfgtvltgdcvvp
sftnpnnlsivtgappsvhgicgnfffdqetqeevlmndakylraptilaemakagqlva
vvtakdklrnllghqlkgicfsaekadqvnleehgvenilarvgmpvpsvysadlsefvf
aaglslltnerpdfmylsttdyvqhkhapgtpeanafyammdsyfkryheqgaivaitad
hgmnaktdaigrpnilflqdlldaqygaqrtrvllpitdpyvvhhgalgsyatvylrdav
pqrdaidflagiagveavltrsqacqrfelpedrigdlvvlgerltvlgsaadkhdlsgl
tvplrshggvseqkvplifnrklvgldspgrlrnfdiidlalnhla

Sequence, based on observed residues (ATOM records): (download)

>d1ei6c_ c.76.1.4 (C:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]}
tnlisvnsrsyrlssaptivicvdgceqeyinqaiqagqapflaeltgfgtvltgdcvvp
sftnpnnlsivtgappsvhgicgnfffdqtqeevlmndakylraptilaemakagqlvav
vtakdklrnllghqlkgicfsaekadqvnleehgvenilarvgmpvpsvysadlsefvfa
aglslltnerpdfmylsttdyvqhkhapgtpeanafyammdsyfkryheqgaivaitadh
gmnaktdaigrpnilflqdlldaqygaqrtrvllpitdpyvvhhgalgsyatvylrdavp
qrdaidflagiagveavltrsqacqrfelpedrigdlvvlgerltvlgsaadkhdlsglt
vplrshggvseqkvplifnrklvglrlrnfdiidlalnhla

SCOPe Domain Coordinates for d1ei6c_:

Click to download the PDB-style file with coordinates for d1ei6c_.
(The format of our PDB-style files is described here.)

Timeline for d1ei6c_: