Lineage for d1ck0l2 (1ck0 L:118-210)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454201Domain d1ck0l2: 1ck0 L:118-210 [90425]
    Other proteins in same PDB: d1ck0h1, d1ck0h2, d1ck0l1
    part of anti-anti-idiotypic Fab against human angiotensin II, unliganded form

Details for d1ck0l2

PDB Entry: 1ck0 (more details), 2.5 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, unliganded form

SCOP Domain Sequences for d1ck0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck0l2 b.1.1.2 (L:118-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
ppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsst
ltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1ck0l2:

Click to download the PDB-style file with coordinates for d1ck0l2.
(The format of our PDB-style files is described here.)

Timeline for d1ck0l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ck0l1