Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
Domain d1cg9a1: 1cg9 A:182-277 [90419] Other proteins in same PDB: d1cg9a2, d1cg9b_ mutant |
PDB Entry: 1cg9 (more details), 2.7 Å
SCOP Domain Sequences for d1cg9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cg9a1 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens)} adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrweps
Timeline for d1cg9a1: