Lineage for d1c7gd_ (1c7g D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131408Protein Tyrosine phenol-lyase [53398] (2 species)
  7. 2131414Species Erwinia herbicola [TaxId:549] [102595] (1 PDB entry)
  8. 2131418Domain d1c7gd_: 1c7g D: [90418]
    complexed with plp

Details for d1c7gd_

PDB Entry: 1c7g (more details), 2.1 Å

PDB Description: tyrosine phenol-lyase from erwinia herbicola
PDB Compounds: (D:) tyrosine phenol-lyase

SCOPe Domain Sequences for d1c7gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7gd_ c.67.1.2 (D:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]}
mnypaepfriksvetvsmisrdervkkmqeagyntfllnskdiyidlltdsgtnamsdkq
wagmmigdeayagsenfyhlektvkelfgfkhivpthqgrgaenllsqlaikpgqyvagn
myftttrfhqekngatfvdivrdeahdaslnlpfkgdidlnklatlikekgaeniayicl
avtvnlaggqpvsmanmravhemastygikifydatrcvenayfikeqeagyenvsikdi
vhemfsyadgctmsgkkdclvniggflcmndeemfsaakelvvvyegmpsygglagrdme
amaiglreamqyeyiehrvkqvrylgdklreagvpiveptgghavfldarrfcphltqdq
fpaqslaasiymetgvrsmergivsagrsketgenhrpkletvrltiprrvytyahmdvv
adgiiklyqhkedirgltfvyepkqlrfftarfdfi

SCOPe Domain Coordinates for d1c7gd_:

Click to download the PDB-style file with coordinates for d1c7gd_.
(The format of our PDB-style files is described here.)

Timeline for d1c7gd_: