Lineage for d1c3vb2 (1c3v B:1106-1214)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414572Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 414573Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 414780Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 414803Protein Dihydrodipicolinate reductase [55371] (2 species)
  7. 414813Species Mycobacterium tuberculosis [TaxId:1773] [103104] (2 PDB entries)
  8. 414817Domain d1c3vb2: 1c3v B:1106-1214 [90414]
    Other proteins in same PDB: d1c3va1, d1c3vb1
    complexed with ndp, pdc, pg4

Details for d1c3vb2

PDB Entry: 1c3v (more details), 2.39 Å

PDB Description: dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc

SCOP Domain Sequences for d1c3vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3vb2 d.81.1.3 (B:1106-1214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis}
aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat
stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr

SCOP Domain Coordinates for d1c3vb2:

Click to download the PDB-style file with coordinates for d1c3vb2.
(The format of our PDB-style files is described here.)

Timeline for d1c3vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c3vb1