Lineage for d1c3vb1 (1c3v B:1001-1105,B:1215-1245)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387801Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 387852Protein Dihydrodipicolinate reductase [51821] (2 species)
  7. 387862Species Mycobacterium tuberculosis [TaxId:1773] [102160] (2 PDB entries)
  8. 387866Domain d1c3vb1: 1c3v B:1001-1105,B:1215-1245 [90413]
    Other proteins in same PDB: d1c3va2, d1c3vb2
    complexed with ndp, pdc, pg4

Details for d1c3vb1

PDB Entry: 1c3v (more details), 2.39 Å

PDB Description: dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc

SCOP Domain Sequences for d1c3vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3vb1 c.2.1.3 (B:1001-1105,B:1215-1245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis}
mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri
aerpgltvgleplldlh

SCOP Domain Coordinates for d1c3vb1:

Click to download the PDB-style file with coordinates for d1c3vb1.
(The format of our PDB-style files is described here.)

Timeline for d1c3vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c3vb2