Lineage for d1c3he_ (1c3h E:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555454Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 555455Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 555456Family b.22.1.1: TNF-like [49843] (12 proteins)
  6. 555457Protein 30 kDa adipocyte complement-related protein [49846] (1 species)
  7. 555458Species Mouse (Mus musculus) [TaxId:10090] [49847] (2 PDB entries)
  8. 555463Domain d1c3he_: 1c3h E: [90409]

Details for d1c3he_

PDB Entry: 1c3h (more details), 2.1 Å

PDB Description: acrp30 calcium complex

SCOP Domain Sequences for d1c3he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3he_ b.22.1.1 (E:) 30 kDa adipocyte complement-related protein {Mouse (Mus musculus)}
aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
nvndstftgfllyhdtn

SCOP Domain Coordinates for d1c3he_:

Click to download the PDB-style file with coordinates for d1c3he_.
(The format of our PDB-style files is described here.)

Timeline for d1c3he_: