Lineage for d1c3hb_ (1c3h B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662727Protein 30 kDa adipocyte complement-related protein [49846] (1 species)
  7. 662728Species Mouse (Mus musculus) [TaxId:10090] [49847] (2 PDB entries)
  8. 662730Domain d1c3hb_: 1c3h B: [90406]

Details for d1c3hb_

PDB Entry: 1c3h (more details), 2.1 Å

PDB Description: acrp30 calcium complex
PDB Compounds: (B:) 30 kd adipocyte complement-related protein precursor

SCOP Domain Sequences for d1c3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3hb_ b.22.1.1 (B:) 30 kDa adipocyte complement-related protein {Mouse (Mus musculus) [TaxId: 10090]}
aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
nvndstftgfllyhdtn

SCOP Domain Coordinates for d1c3hb_:

Click to download the PDB-style file with coordinates for d1c3hb_.
(The format of our PDB-style files is described here.)

Timeline for d1c3hb_: