SCOP 1.67: Domain d1m61a2: 1m61 A:133-256

Lineage for d1m61a2 (1m61 A:133-256)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (28 proteins)

6. Protein Tyrosine-protein kinase zap-70 [89996] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89997] (1 PDB entry)

8. Domain d1m61a2: 1m61 A:133-256 [90399]
   complexed with po4

Details for d1m61a2

PDB Entry: 1m61, 2.5 Å

PDB Description: crystal structure of the apo sh2 domains of zap-70

SCOP Domain Sequences for d1m61a2:

Sequence; same for both SEQRES and ATOM records:

>d1m61a2 d.93.1.1 (A:133-256) Tyrosine-protein kinase zap-70 {Human (Homo sapiens)}
legealeqaiisqapqvekliattahermpwyhssltreeaerklysgaqtdgkfllrpr
keqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklkadgliyclke
acpn

Timeline for d1m61a2:

• d1m61a2 is new in SCOP 1.67
  
• d1m61a2 appears in SCOP 1.69
  
• d1m61a2 appears in the current release, SCOPe 2.08