Lineage for d1m61a1 (1m61 A:1-132)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206882Protein Tyrosine-protein kinase zap-70 [89996] (1 species)
  7. 2206883Species Human (Homo sapiens) [TaxId:9606] [89997] (2 PDB entries)
  8. 2206886Domain d1m61a1: 1m61 A:1-132 [90398]
    Other proteins in same PDB: d1m61a3
    complexed with po4

Details for d1m61a1

PDB Entry: 1m61 (more details), 2.5 Å

PDB Description: crystal structure of the apo sh2 domains of zap-70
PDB Compounds: (A:) tyrosine-protein kinase zap-70

SCOPe Domain Sequences for d1m61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m61a1 d.93.1.1 (A:1-132) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}
mpdpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfhhfp
ierqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdclrd
amvrdyvrqtwk

SCOPe Domain Coordinates for d1m61a1:

Click to download the PDB-style file with coordinates for d1m61a1.
(The format of our PDB-style files is described here.)

Timeline for d1m61a1: