Lineage for d1m2wa4 (1m2w A:1-286)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1153339Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1153441Protein Mannitol 2-dehydrogenase [82301] (1 species)
  7. 1153442Species Pseudomonas fluorescens [TaxId:294] [82302] (2 PDB entries)
  8. 1153444Domain d1m2wa4: 1m2w A:1-286 [90395]
    Other proteins in same PDB: d1m2wa3, d1m2wb3
    complexed with mtl, nad

Details for d1m2wa4

PDB Entry: 1m2w (more details), 1.8 Å

PDB Description: Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and D-mannitol
PDB Compounds: (A:) mannitol dehydrogenase

SCOPe Domain Sequences for d1m2wa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2wa4 c.2.1.6 (A:1-286) Mannitol 2-dehydrogenase {Pseudomonas fluorescens [TaxId: 294]}
mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftd

SCOPe Domain Coordinates for d1m2wa4:

Click to download the PDB-style file with coordinates for d1m2wa4.
(The format of our PDB-style files is described here.)

Timeline for d1m2wa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m2wa3