Lineage for d1ksva4 (1ksv A:60-231)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946723Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1946724Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 1946766Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 1946776Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)
  7. 1946777Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)
  8. 1946780Domain d1ksva4: 1ksv A:60-231 [90391]
    Other proteins in same PDB: d1ksva3
    complexed with u

Details for d1ksva4

PDB Entry: 1ksv (more details), 2.65 Å

PDB Description: structure of rsua
PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1ksva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksva4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli [TaxId: 562]}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltis
egryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv

SCOPe Domain Coordinates for d1ksva4:

Click to download the PDB-style file with coordinates for d1ksva4.
(The format of our PDB-style files is described here.)

Timeline for d1ksva4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksva3