Lineage for d1ksva4 (1ksv A:60-231)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617005Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 617006Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 617022Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 617032Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)
  7. 617033Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)
  8. 617036Domain d1ksva4: 1ksv A:60-231 [90391]
    Other proteins in same PDB: d1ksva3
    complexed with mse, u

Details for d1ksva4

PDB Entry: 1ksv (more details), 2.65 Å

PDB Description: structure of rsua

SCOP Domain Sequences for d1ksva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksva4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltis
egryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv

SCOP Domain Coordinates for d1ksva4:

Click to download the PDB-style file with coordinates for d1ksva4.
(The format of our PDB-style files is described here.)

Timeline for d1ksva4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksva3