Lineage for d1ksla4 (1ksl A:60-231)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615008Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615009Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2615053Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 2615063Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)
  7. 2615064Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)
  8. 2615066Domain d1ksla4: 1ksl A:60-231 [90390]
    Other proteins in same PDB: d1ksla3
    complexed with ura

Details for d1ksla4

PDB Entry: 1ksl (more details), 2.1 Å

PDB Description: structure of rsua
PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1ksla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksla4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli [TaxId: 562]}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltis
egryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv

SCOPe Domain Coordinates for d1ksla4:

Click to download the PDB-style file with coordinates for d1ksla4.
(The format of our PDB-style files is described here.)

Timeline for d1ksla4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksla3