Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins) contains N-terminal alpha-L RNA-binding motif |
Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species) |
Species Escherichia coli [TaxId:562] [75461] (3 PDB entries) |
Domain d1ksla4: 1ksl A:60-231 [90390] Other proteins in same PDB: d1ksla3 complexed with ura |
PDB Entry: 1ksl (more details), 2.1 Å
SCOPe Domain Sequences for d1ksla4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksla4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli [TaxId: 562]} pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh ritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltis egryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv
Timeline for d1ksla4: