SCOPe 2.05: Domain d1kska4: 1ksk A:60-231

Lineage for d1kska4 (1ksk A:60-231)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)

7. Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)

8. Domain d1kska4: 1ksk A:60-231 [90389]
   Other proteins in same PDB: d1kska3
   complexed with ura

Details for d1kska4

PDB Entry: 1ksk, 2 Å

PDB Description: structure of rsua

PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1kska4:

Sequence; same for both SEQRES and ATOM records:

>d1kska4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli [TaxId: 562]}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltis
egryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv

Timeline for d1kska4:

• d1kska4 first appeared in SCOP 1.67
  
• d1kska4 appears in SCOPe 2.04
  
• d1kska4 appears in SCOPe 2.06
  
• d1kska4 appears in the current release, SCOPe 2.08