Lineage for d1k8wa5 (1k8w A:9-250)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946723Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1946724Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 1946739Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 1946740Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 1946741Species Escherichia coli [TaxId:562] [69748] (3 PDB entries)
  8. 1946742Domain d1k8wa5: 1k8w A:9-250 [90388]
    Other proteins in same PDB: d1k8wa3
    protein/RNA complex; complexed with so4

Details for d1k8wa5

PDB Entry: 1k8w (more details), 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1k8wa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8wa5 d.265.1.2 (A:9-250) Pseudouridine synthase II TruB {Escherichia coli [TaxId: 562]}
mdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsqy
lldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysa
lkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlg
eklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspa
sd

SCOPe Domain Coordinates for d1k8wa5:

Click to download the PDB-style file with coordinates for d1k8wa5.
(The format of our PDB-style files is described here.)

Timeline for d1k8wa5: