SCOPe 2.08: Domain d1k1qb1: 1k1q B:240-344

Lineage for d1k1qb1 (1k1q B:240-344)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [100883] (2 PDB entries)

8. Domain d1k1qb1: 1k1q B:240-344 [90384]
   Other proteins in same PDB: d1k1qa2, d1k1qb2

Details for d1k1qb1

PDB Entry: 1k1q, 2.8 Å

PDB Description: crystal structure of a dinb family error prone dna polymerase from sulfolobus solfataricus

PDB Compounds: (B:) DBH protein

SCOPe Domain Sequences for d1k1qb1:

Sequence; same for both SEQRES and ATOM records:

>d1k1qb1 d.240.1.1 (B:240-344) DinB homolog (DBH) {Sulfolobus solfataricus [TaxId: 2287]}
nkskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskg
kkfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

Timeline for d1k1qb1:

• d1k1qb1 first appeared in SCOP 1.67
  
• d1k1qb1 appears in SCOPe 2.07