Lineage for d1k1qa1 (1k1q A:240-344)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614248Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2614249Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2614250Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 2614251Protein DinB homolog (DBH) [100881] (3 species)
  7. 2614256Species Sulfolobus solfataricus [TaxId:2287] [100883] (2 PDB entries)
  8. 2614258Domain d1k1qa1: 1k1q A:240-344 [90382]
    Other proteins in same PDB: d1k1qa2, d1k1qb2

Details for d1k1qa1

PDB Entry: 1k1q (more details), 2.8 Å

PDB Description: crystal structure of a dinb family error prone dna polymerase from sulfolobus solfataricus
PDB Compounds: (A:) DBH protein

SCOPe Domain Sequences for d1k1qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1qa1 d.240.1.1 (A:240-344) DinB homolog (DBH) {Sulfolobus solfataricus [TaxId: 2287]}
nkskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskg
kkfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

SCOPe Domain Coordinates for d1k1qa1:

Click to download the PDB-style file with coordinates for d1k1qa1.
(The format of our PDB-style files is described here.)

Timeline for d1k1qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k1qa2