Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) |
Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
Protein DinB homolog (DBH) [100881] (2 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [100883] (2 PDB entries) |
Domain d1k1qa1: 1k1q A:240-344 [90382] Other proteins in same PDB: d1k1qa2, d1k1qb2 |
PDB Entry: 1k1q (more details), 2.8 Å
SCOP Domain Sequences for d1k1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1qa1 d.240.1.1 (A:240-344) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} nkskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskg kkfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin
Timeline for d1k1qa1: