![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
![]() | Protein DinB homolog (DBH) [100889] (2 species) |
![]() | Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (11 PDB entries) |
![]() | Domain d1jxla2: 1jxl A:1-240 [90381] Other proteins in same PDB: d1jxla1 |
PDB Entry: 1jxl (more details), 2.1 Å
SCOP Domain Sequences for d1jxla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxla2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV} mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d1jxla2: