SCOPe 2.08: Domain d1jx4a1: 1jx4 A:241-341

Lineage for d1jx4a1 (1jx4 A:241-341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d1jx4a1: 1jx4 A:241-341 [90378]
   Other proteins in same PDB: d1jx4a2
   protein/DNA complex; complexed with adi, ca, mg

Details for d1jx4a1

PDB Entry: 1jx4, 1.7 Å

PDB Description: Crystal Structure of a Y-family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide

PDB Compounds: (A:) DNA polymerase IV (family Y)

SCOPe Domain Sequences for d1jx4a1:

Sequence; same for both SEQRES and ATOM records:

>d1jx4a1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d1jx4a1:

• d1jx4a1 first appeared in SCOP 1.67
  
• d1jx4a1 appears in SCOPe 2.07