Lineage for d1jihb2 (1jih B:1-389)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424812Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (2 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 424838Protein DNA polymerase eta [100892] (1 species)
  7. 424839Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [100893] (1 PDB entry)
  8. 424841Domain d1jihb2: 1jih B:1-389 [90377]
    Other proteins in same PDB: d1jiha1, d1jihb1

Details for d1jihb2

PDB Entry: 1jih (more details), 2.25 Å

PDB Description: Yeast DNA Polymerase ETA

SCOP Domain Sequences for d1jihb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jihb2 e.8.1.7 (B:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae)}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

SCOP Domain Coordinates for d1jihb2:

Click to download the PDB-style file with coordinates for d1jihb2.
(The format of our PDB-style files is described here.)

Timeline for d1jihb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jihb1