Lineage for d1jeyb1 (1jey B:242-545)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473056Fold b.131: SPOC domain-like [100938] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 473057Superfamily b.131.1: SPOC domain-like [100939] (3 families) (S)
  5. 473063Family b.131.1.2: Ku80 subunit middle domain [100943] (1 protein)
    includes C-terminal alpha-helical arm and DNA encircling insertion
  6. 473064Protein Ku80 subunit middle domain [100944] (1 species)
  7. 473065Species Human (Homo sapiens) [TaxId:9606] [100945] (2 PDB entries)
  8. 473066Domain d1jeyb1: 1jey B:242-545 [90372]
    Other proteins in same PDB: d1jeya1, d1jeya2, d1jeyb2

Details for d1jeyb1

PDB Entry: 1jey (more details), 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna

SCOP Domain Sequences for d1jeyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeyb1 b.131.1.2 (B:242-545) Ku80 subunit middle domain {Human (Homo sapiens)}
rhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclnddd
etevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqv
lkvfaarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvy
vqlpfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttk
ipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplie
akkk

SCOP Domain Coordinates for d1jeyb1:

Click to download the PDB-style file with coordinates for d1jeyb1.
(The format of our PDB-style files is described here.)

Timeline for d1jeyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jeyb2