SCOPe 2.08: Domain d1jeyb1: 1jey B:242-545

Lineage for d1jeyb1 (1jey B:242-545)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.131: SPOC domain-like [100938] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.131.1: SPOC domain-like [100939] (3 families)

5. Family b.131.1.2: Ku80 subunit middle domain [100943] (1 protein)
   includes C-terminal alpha-helical arm and DNA encircling insertion

6. Protein Ku80 subunit middle domain [100944] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [100945] (2 PDB entries)

8. Domain d1jeyb1: 1jey B:242-545 [90372]
   Other proteins in same PDB: d1jeya1, d1jeya2, d1jeyb2
   protein/DNA complex

Details for d1jeyb1

PDB Entry: 1jey, 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna

PDB Compounds: (B:) Ku80

SCOPe Domain Sequences for d1jeyb1:

Sequence; same for both SEQRES and ATOM records:

>d1jeyb1 b.131.1.2 (B:242-545) Ku80 subunit middle domain {Human (Homo sapiens) [TaxId: 9606]}
rhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclnddd
etevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqv
lkvfaarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvy
vqlpfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttk
ipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplie
akkk

Timeline for d1jeyb1:

• d1jeyb1 first appeared in SCOP 1.67
  
• d1jeyb1 appears in SCOPe 2.07