Lineage for d1jeya2 (1jey A:34-253)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864111Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1864112Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1864288Family c.62.1.3: Ku70 subunit N-terminal domain [100959] (1 protein)
    automatically mapped to Pfam PF03731
  6. 1864289Protein Ku70 subunit N-terminal domain [100960] (1 species)
  7. 1864290Species Human (Homo sapiens) [TaxId:9606] [100961] (2 PDB entries)
  8. 1864291Domain d1jeya2: 1jey A:34-253 [90371]
    Other proteins in same PDB: d1jeya1, d1jeyb1, d1jeyb2
    protein/DNA complex

Details for d1jeya2

PDB Entry: 1jey (more details), 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna
PDB Compounds: (A:) Ku70

SCOPe Domain Sequences for d1jeya2:

Sequence, based on SEQRES records: (download)

>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
slfyrdiisiaededlrvhfeesskledllrkvraketrk

Sequence, based on observed residues (ATOM records): (download)

>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
slfyrdiisvhfeesskledllrkvraketrk

SCOPe Domain Coordinates for d1jeya2:

Click to download the PDB-style file with coordinates for d1jeya2.
(The format of our PDB-style files is described here.)

Timeline for d1jeya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jeya1