Lineage for d1jeya1 (1jey A:254-534)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433390Fold b.131: SPOC domain-like [100938] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2433391Superfamily b.131.1: SPOC domain-like [100939] (3 families) (S)
  5. 2433392Family b.131.1.1: Ku70 subunit middle domain [100940] (1 protein)
    includes C-terminal alpha-helical arm and DNA encircling insertion
  6. 2433393Protein Ku70 subunit middle domain [100941] (1 species)
  7. 2433394Species Human (Homo sapiens) [TaxId:9606] [100942] (2 PDB entries)
  8. 2433395Domain d1jeya1: 1jey A:254-534 [90370]
    Other proteins in same PDB: d1jeya2, d1jeyb1, d1jeyb2
    protein/DNA complex

Details for d1jeya1

PDB Entry: 1jey (more details), 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna
PDB Compounds: (A:) Ku70

SCOPe Domain Sequences for d1jeya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeya1 b.131.1.1 (A:254-534) Ku70 subunit middle domain {Human (Homo sapiens) [TaxId: 9606]}
ralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktktrtfntstgglllp
sdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhhylrpslfvypees
lvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeelddqkiqvtppgfq
lvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfenpvlqqhfrnleal
aldlmepeqavdltlpkveamnkrlgslvdefkelvyppdy

SCOPe Domain Coordinates for d1jeya1:

Click to download the PDB-style file with coordinates for d1jeya1.
(The format of our PDB-style files is described here.)

Timeline for d1jeya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jeya2