Lineage for d1jeqa3 (1jeq A:254-538)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813513Fold b.131: SPOC domain-like [100938] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 813514Superfamily b.131.1: SPOC domain-like [100939] (3 families) (S)
  5. 813515Family b.131.1.1: Ku70 subunit middle domain [100940] (1 protein)
    includes C-terminal alpha-helical arm and DNA encircling insertion
  6. 813516Protein Ku70 subunit middle domain [100941] (1 species)
  7. 813517Species Human (Homo sapiens) [TaxId:9606] [100942] (2 PDB entries)
  8. 813519Domain d1jeqa3: 1jeq A:254-538 [90366]
    Other proteins in same PDB: d1jeqa1, d1jeqa4, d1jeqb1, d1jeqb2

Details for d1jeqa3

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: crystal structure of the ku heterodimer
PDB Compounds: (A:) Ku70

SCOP Domain Sequences for d1jeqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeqa3 b.131.1.1 (A:254-538) Ku70 subunit middle domain {Human (Homo sapiens) [TaxId: 9606]}
ralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktktrtfntstgglllp
sdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhhylrpslfvypees
lvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeelddqkiqvtppgfq
lvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfenpvlqqhfrnleal
aldlmepeqavdltlpkveamnkrlgslvdefkelvyppdynpeg

SCOP Domain Coordinates for d1jeqa3:

Click to download the PDB-style file with coordinates for d1jeqa3.
(The format of our PDB-style files is described here.)

Timeline for d1jeqa3: