Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) |
Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins) |
Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100912] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [100913] (4 PDB entries) |
Domain d1hg5a2: 1hg5 A:19-149 [90361] Other proteins in same PDB: d1hg5a1 complexed with ihp |
PDB Entry: 1hg5 (more details), 2 Å
SCOPe Domain Sequences for d1hg5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hg5a2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]} gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy rqvafdftkvk
Timeline for d1hg5a2: