SCOPe 2.08: Domain d1hg5a2: 1hg5 A:19-149

Lineage for d1hg5a2 (1hg5 A:19-149)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins)

6. Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100912] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [100913] (4 PDB entries)

8. Domain d1hg5a2: 1hg5 A:19-149 [90361]
   Other proteins in same PDB: d1hg5a1
   complexed with ihp

Details for d1hg5a2

PDB Entry: 1hg5, 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex

PDB Compounds: (A:) clathrin assembly protein short form

SCOPe Domain Sequences for d1hg5a2:

Sequence; same for both SEQRES and ATOM records:

>d1hg5a2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvk

Timeline for d1hg5a2:

• d1hg5a2 first appeared in SCOP 1.67
  
• d1hg5a2 appears in SCOPe 2.07