![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
![]() | Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins) this domain is associated with the N-terminal ENTH-like domain |
![]() | Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100930] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [100931] (4 PDB entries) |
![]() | Domain d1hg5a1: 1hg5 A:150-281 [90360] Other proteins in same PDB: d1hg5a2 complexed with ihp |
PDB Entry: 1hg5 (more details), 2 Å
SCOPe Domain Sequences for d1hg5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hg5a1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]} rgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlfa aynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdlsq apsslldaleqh
Timeline for d1hg5a1: